by Reportandie
Sat Dec 22, 2012 4:43 pm
Delivered-To: [my.redacted.address]
Received: by 10.194.23.98 with SMTP id l2csp32477wjf;
Thu, 20 Dec 2012 15:18:58 -0800 (PST)
X-Received: by 10.14.203.8 with SMTP id e8mr27047361eeo.2.1356045537059;
Thu, 20 Dec 2012 15:18:57 -0800 (PST)
Return-Path: <[email protected]>
Received: from mail2.ukrpost.ua (mail2.ukrpost.ua. [82.207.79.2])
by mx.google.com with ESMTP id s42si23374954eem.130.2012.12.20.15.13.28;
Thu, 20 Dec 2012 15:18:57 -0800 (PST)
Received-SPF: pass (google.com: domain of [email protected] designates 82.207.79.2 as permitted sender) client-ip=82.207.79.2;
Authentication-Results: mx.google.com; spf=pass (google.com: domain of [email protected] designates 82.207.79.2 as permitted sender) [email protected]
Message-Id: <50d39ce1.c2b80e0a.194a.ffff902cSMTPIN_ADDED_MISSING@mx.google.com>
Received: from h2087793.stratoserver.net ([81.169.177.254] helo=User)
by mail2.ukrpost.ua with esmtpa (Exim 4.74)
(envelope-from <[email protected]>)
id 1TlpIg-0007rj-O4; Fri, 21 Dec 2012 01:13:16 +0200
Reply-To: <[email protected]>
From: "Barr. Ese Ogidi"<[email protected]>
Subject: From Barr. Ese Ogidi
Date: Fri, 21 Dec 2012 00:13:15 +0100
MIME-Version: 1.0
Content-Type: text/html;
charset="Windows-1251"
Content-Transfer-Encoding: 7bit
X-Priority: 3
X-MSMail-Priority: Normal
X-Mailer: Microsoft Outlook Express 6.00.2600.0000
X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2600.0000
X-Drweb-SpamState: yes
X-Drweb-SpamScore: 560
X-DrWeb-SpamReason: gggruggvucftvghtrhhoucdtuddrfeehledrtdehucetufdoteggodetrfcurfhrohhfihhlvgemuceonhhonhgvqeenuceurghilhhouhhtmecupfdsteenucfjughrucdvfedtucdlvddttddmnehmihhsshhinhhgucfvqfcufhhivghlugculdeftddmnegopfhokfffucdluddtmdenogevhihrihhllhhitgdqqdfntfdqqdfgmhhpthihkfffucdlvddtmdennddoufgtrghmhidqofhonhgvhidqfhhrqdgvnhculdeftddtmd
X-Antivirus: Dr.Web (R) for Unix mail servers drweb plugin ver.6.0.0.0
X-Antivirus-Code: 0x100000
Good day,
I know this message will come as a surprise to you but I will want you to please take a little time of yours to go through the below information for future benefits.
My Name is Barrister Ese Ogidi f i n a n c i a l adviser to James Ibori former Governor to Delta State in Nigeria. I want to use this medium to seek for an assistance of a foreign partner and a c c o u n t where we can d e p o s i t f u n d s that is currently in Canada to avoid any eyebrow to know where this is d e p o s i t e d as advised by the f i n a n c i a l firm in charge of the d e p o s i t.
Many of his f u n d s has been frozen by the UK Government and sentence the person in question to 13years in Jail, this very f u n d s were just the last set of f u n d s that was moved on my name before he was arrested in Dubai moved to UK for persecution, and I am in charge of it and want to use it as my personal benefit during my tenor in the Nigeria Government with James Ibori as his f i n a n c i a l adviser. He has made away with lot of f u n d s pushed to many of this country abroad, have properties almost every where oversea.
This is a great opportunity for me to establish my own i n v e s t m e n t abroad with a partner that wishes. For confirmation I will leave you with the below link….
BBC News - Former Nigeria governor James Ibori jailed for 13 years
www.bbc.co.uk/news/world-africa-17739388
>
BBC News - UK aid f u n d e d firms 'linked to Nigeria f r a u d s t e r Ibori'
www.bbc.co.uk/news/world-africa-17728357
The S e c u r e d F i n a n c i a l House are not able to perfect the t r a n s f e r to any designated b a n k a c c o u n t due largely to f i n a n c i a l t r a n s fe r r e s t r i c t i o n globally that is aimed at curbing t e r r o r i s t f u n d i n g and m o n e y l a u n de r i n g. Therefore I have spoken with some international m o n e t a r y experts, who at different occasion suggest moving the f u n d s in pallet as d i p l o m a t i c luggage into a level playing ground.
This suggestion prompted my negotiation with a s o p h i s t i c a t e d d i p l o m a t i c security outfit in London, UK that promised to help for the evacuation of the f u n d s to Fair Ground soon as we are ready with all valid documentation to that effect. Immediately the evacuation is made a facilitator will accompany the c o n s i g n m e n t to suggested Ground.
From the foregoing I want to know your opinion about coming down to Canada to meet with my representative to discuss the strategy and process for the delivery or up stand do l o d g e m e n t in any b a n k there. Please get back to me quickly.
There after, I will confirm how this t r a n s a c t i o n will go if agreement is reached by your acceptance and urgency.
I will like to complete this t r a n s a c t i o n before the 20th of December.
Hope to hear from you soonest.
Barr. Ese Ogidi.
Received: by 10.194.23.98 with SMTP id l2csp32477wjf;
Thu, 20 Dec 2012 15:18:58 -0800 (PST)
X-Received: by 10.14.203.8 with SMTP id e8mr27047361eeo.2.1356045537059;
Thu, 20 Dec 2012 15:18:57 -0800 (PST)
Return-Path: <[email protected]>
Received: from mail2.ukrpost.ua (mail2.ukrpost.ua. [82.207.79.2])
by mx.google.com with ESMTP id s42si23374954eem.130.2012.12.20.15.13.28;
Thu, 20 Dec 2012 15:18:57 -0800 (PST)
Received-SPF: pass (google.com: domain of [email protected] designates 82.207.79.2 as permitted sender) client-ip=82.207.79.2;
Authentication-Results: mx.google.com; spf=pass (google.com: domain of [email protected] designates 82.207.79.2 as permitted sender) [email protected]
Message-Id: <50d39ce1.c2b80e0a.194a.ffff902cSMTPIN_ADDED_MISSING@mx.google.com>
Received: from h2087793.stratoserver.net ([81.169.177.254] helo=User)
by mail2.ukrpost.ua with esmtpa (Exim 4.74)
(envelope-from <[email protected]>)
id 1TlpIg-0007rj-O4; Fri, 21 Dec 2012 01:13:16 +0200
Reply-To: <[email protected]>
From: "Barr. Ese Ogidi"<[email protected]>
Subject: From Barr. Ese Ogidi
Date: Fri, 21 Dec 2012 00:13:15 +0100
MIME-Version: 1.0
Content-Type: text/html;
charset="Windows-1251"
Content-Transfer-Encoding: 7bit
X-Priority: 3
X-MSMail-Priority: Normal
X-Mailer: Microsoft Outlook Express 6.00.2600.0000
X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2600.0000
X-Drweb-SpamState: yes
X-Drweb-SpamScore: 560
X-DrWeb-SpamReason: gggruggvucftvghtrhhoucdtuddrfeehledrtdehucetufdoteggodetrfcurfhrohhfihhlvgemuceonhhonhgvqeenuceurghilhhouhhtmecupfdsteenucfjughrucdvfedtucdlvddttddmnehmihhsshhinhhgucfvqfcufhhivghlugculdeftddmnegopfhokfffucdluddtmdenogevhihrihhllhhitgdqqdfntfdqqdfgmhhpthihkfffucdlvddtmdennddoufgtrghmhidqofhonhgvhidqfhhrqdgvnhculdeftddtmd
X-Antivirus: Dr.Web (R) for Unix mail servers drweb plugin ver.6.0.0.0
X-Antivirus-Code: 0x100000
Good day,
I know this message will come as a surprise to you but I will want you to please take a little time of yours to go through the below information for future benefits.
My Name is Barrister Ese Ogidi f i n a n c i a l adviser to James Ibori former Governor to Delta State in Nigeria. I want to use this medium to seek for an assistance of a foreign partner and a c c o u n t where we can d e p o s i t f u n d s that is currently in Canada to avoid any eyebrow to know where this is d e p o s i t e d as advised by the f i n a n c i a l firm in charge of the d e p o s i t.
Many of his f u n d s has been frozen by the UK Government and sentence the person in question to 13years in Jail, this very f u n d s were just the last set of f u n d s that was moved on my name before he was arrested in Dubai moved to UK for persecution, and I am in charge of it and want to use it as my personal benefit during my tenor in the Nigeria Government with James Ibori as his f i n a n c i a l adviser. He has made away with lot of f u n d s pushed to many of this country abroad, have properties almost every where oversea.
This is a great opportunity for me to establish my own i n v e s t m e n t abroad with a partner that wishes. For confirmation I will leave you with the below link….
BBC News - Former Nigeria governor James Ibori jailed for 13 years
www.bbc.co.uk/news/world-africa-17739388
>
BBC News - UK aid f u n d e d firms 'linked to Nigeria f r a u d s t e r Ibori'
www.bbc.co.uk/news/world-africa-17728357
The S e c u r e d F i n a n c i a l House are not able to perfect the t r a n s f e r to any designated b a n k a c c o u n t due largely to f i n a n c i a l t r a n s fe r r e s t r i c t i o n globally that is aimed at curbing t e r r o r i s t f u n d i n g and m o n e y l a u n de r i n g. Therefore I have spoken with some international m o n e t a r y experts, who at different occasion suggest moving the f u n d s in pallet as d i p l o m a t i c luggage into a level playing ground.
This suggestion prompted my negotiation with a s o p h i s t i c a t e d d i p l o m a t i c security outfit in London, UK that promised to help for the evacuation of the f u n d s to Fair Ground soon as we are ready with all valid documentation to that effect. Immediately the evacuation is made a facilitator will accompany the c o n s i g n m e n t to suggested Ground.
From the foregoing I want to know your opinion about coming down to Canada to meet with my representative to discuss the strategy and process for the delivery or up stand do l o d g e m e n t in any b a n k there. Please get back to me quickly.
There after, I will confirm how this t r a n s a c t i o n will go if agreement is reached by your acceptance and urgency.
I will like to complete this t r a n s a c t i o n before the 20th of December.
Hope to hear from you soonest.
Barr. Ese Ogidi.